PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0013s0150.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 231aa    MW: 25217 Da    PI: 8.9971
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0013s0150.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.3e-392080262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++++++cprC+stntkfCyynnys +qPryfCkaCrryWt+GG+lrnvPvGgg+rknk+s+
  SapurV1A.0013s0150.3.p 20 PQEQVNCPRCNSTNTKFCYYNNYSFTQPRYFCKACRRYWTEGGSLRNVPVGGGSRKNKRST 80
                            6899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271978IPR003851Zinc finger, Dof-type
PfamPF027013.8E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8822478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDEMASNSCG RPVPERKARP QEQVNCPRCN STNTKFCYYN NYSFTQPRYF CKACRRYWTE  60
GGSLRNVPVG GGSRKNKRST SSSVAASSSK LPDLNPPSLS HFSSQNPKSI HEGQDLNLAF  120
PAMQDSQAME LLRSGIDSRG LNPFIPSPMP DSNTLYSSGG FPLQEIKPTL SFSVDGLGSR  180
YGIQENSGRI LFPFGELKQH SSTPSEIDQN KGQGTSSGYW NGMFGGGSSW *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375374.11e-144hypothetical protein POPTR_0014s09640g
SwissprotQ433855e-78DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLU5FT891e-144U5FT89_POPTR; Uncharacterized protein
STRINGPOPTR_0002s17490.11e-139(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.34e-77Dof family protein